PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr017972.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family MYB
Protein Properties Length: 529aa    MW: 59674.7 Da    PI: 7.2946
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr017972.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding46.21.1e-14236282148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g W++eEd  lv++v ++G + W+ Ia+ +  gR +kqc++rw+++l
      Pbr017972.1 236 KGQWSPEEDRHLVQLVGRFGIKKWSDIANQLT-GRVGKQCRERWHNHL 282
                      799****************************9.*************97 PP

2Myb_DNA-binding51.62.1e-16289330245
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                        W++eEd++l++a+k++G++ W+  a+ ++ gRt++ +k++w+
      Pbr017972.1 289 EVWSEEEDKILIEAHKKMGNR-WAEMAKILP-GRTENTIKNHWN 330
                      68*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129427.342231286IPR017930Myb domain
SuperFamilySSF466897.91E-31233329IPR009057Homeodomain-like
SMARTSM007179.7E-12235284IPR001005SANT/Myb domain
PfamPF002491.8E-13236282IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.6E-25237287IPR009057Homeodomain-like
CDDcd001671.74E-11239282No hitNo description
SMARTSM007175.2E-16287335IPR001005SANT/Myb domain
PROSITE profilePS5129418.761287337IPR017930Myb domain
Gene3DG3DSA:1.10.10.606.2E-21288335IPR009057Homeodomain-like
PfamPF002497.1E-15288330IPR001005SANT/Myb domain
CDDcd001674.24E-13291333No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 529 aa     Download sequence    Send to blast
MEYLETNLRE LDNFPLISTL LYGSSNPLKL MKPENPPPTT IKTTTTNGNL YSLSRSSPPP  60
PSSPKALFHH PNSINHGFNR VSHSHEYNLT PKTDHFTTEA GSSSNPFNKI STTCNTLNNP  120
FEPSPYTPNY HRHHLVISDC GESELVAMHG FHDGVRGCLG YRPDHQEIPH DQQMGSESCV  180
QLPPLVIYGE FGSSSAPAMR LPSDDIPRLS ADEKKSKRLC EGGAIKLLHK KPDIIKGQWS  240
PEEDRHLVQL VGRFGIKKWS DIANQLTGRV GKQCRERWHN HLRPDIRKEV WSEEEDKILI  300
EAHKKMGNRW AEMAKILPGR TENTIKNHWN ATKRKQNSKR KSNKQDSSNN NYNESSMLQD  360
YIRSVVSSTT TGTPSTASAN STGAMENKAV LSSVVSPDHQ SGMHINQNNI VESPDATNSV  420
NWDLTGYRPE PFDSEASNMN NHMVDGVTTL SDFDKSNMFN IFESYGLGGY LQQRMASSST  480
SRVKDPSCSM EYELPFFPLE MNNFMRGHDD HFKKELDSME MLHFKRNM*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-452323383110B-MYB
1h88_C3e-4523233654158MYB PROTO-ONCOGENE PROTEIN
1h89_C3e-4523233654158MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008341722.10.0PREDICTED: transcription factor MYB98-like
TrEMBLM5X7L21e-100M5X7L2_PRUPE; Uncharacterized protein (Fragment)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF1709548
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18770.12e-51myb domain protein 98